Lineage for d2nuab2 (2nua B:1-238)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1041792Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1041793Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families) (S)
  5. 1041979Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
  6. 1041980Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)
  7. 1041981Species Escherichia coli [TaxId:562] [56083] (11 PDB entries)
  8. 1042000Domain d2nuab2: 2nua B:1-238 [148439]
    Other proteins in same PDB: d2nuaa1, d2nuaa2, d2nuab1, d2nuad1, d2nuad2, d2nuae1
    automatically matched to d1cqib2
    complexed with coa, po4, so4; mutant

Details for d2nuab2

PDB Entry: 2nua (more details), 2.95 Å

PDB Description: c123av mutant of e. coli succinyl-coa synthetase
PDB Compounds: (B:) succinyl-coa synthetase beta chain

SCOPe Domain Sequences for d2nuab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nuab2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]}
mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe

SCOPe Domain Coordinates for d2nuab2:

Click to download the PDB-style file with coordinates for d2nuab2.
(The format of our PDB-style files is described here.)

Timeline for d2nuab2: