Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.10: CoxG-like [160750] (2 proteins) Pfam PF06240 |
Protein Hypothetical protein APE2225 [160751] (1 species) |
Species Aeropyrum pernix [TaxId:56636] [160752] (1 PDB entry) Uniprot Q9Y9R3 1-147 |
Domain d2ns9b_: 2ns9 B: [148383] automated match to d2ns9a1 complexed with po4 |
PDB Entry: 2ns9 (more details), 1.8 Å
SCOPe Domain Sequences for d2ns9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ns9b_ d.129.3.10 (B:) Hypothetical protein APE2225 {Aeropyrum pernix [TaxId: 56636]} rlhagvwglkvryegsfevsktpeevfefltdpkrfsrafpgfksvevedgsftielrls lgplrgdarvrasfedlekpskatvkgsgrgagstldftlrfavepsgggsrvswvfegn vgglaasmggrvldslarrmindvisgvkrel
Timeline for d2ns9b_: