SCOPe 2.04: Domain d2ns9b_: 2ns9 B:

Lineage for d2ns9b_ (2ns9 B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.10: CoxG-like [160750] (2 proteins)
   Pfam PF06240

6. Protein Hypothetical protein APE2225 [160751] (1 species)

7. Species Aeropyrum pernix [TaxId:56636] [160752] (1 PDB entry)
   Uniprot Q9Y9R3 1-147

8. Domain d2ns9b_: 2ns9 B: [148383]
   automated match to d2ns9a1
   complexed with po4

Details for d2ns9b_

PDB Entry: 2ns9, 1.8 Å

PDB Description: crystal structure of protein ape2225 from aeropyrum pernix k1, pfam coxg

PDB Compounds: (B:) Hypothetical protein APE2225

SCOPe Domain Sequences for d2ns9b_:

Sequence; same for both SEQRES and ATOM records:

>d2ns9b_ d.129.3.10 (B:) Hypothetical protein APE2225 {Aeropyrum pernix [TaxId: 56636]}
rlhagvwglkvryegsfevsktpeevfefltdpkrfsrafpgfksvevedgsftielrls
lgplrgdarvrasfedlekpskatvkgsgrgagstldftlrfavepsgggsrvswvfegn
vgglaasmggrvldslarrmindvisgvkrel

Timeline for d2ns9b_:

• d2ns9b_ first appeared in SCOP 1.75, called d2ns9b1
  
• d2ns9b_ appears in SCOPe 2.03
  
• d2ns9b_ appears in SCOPe 2.05
  
• d2ns9b_ appears in the current release, SCOPe 2.08