Lineage for d2nojh1 (2noj H:52-109)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1081581Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1081935Superfamily a.7.17: Efb C-domain-like [158366] (1 family) (S)
  5. 1081936Family a.7.17.1: Efb C-domain-like [158367] (2 proteins)
    PfamB PB008033
    this is a repeat family; one repeat unit is 2gom A:105-165 found in domain
  6. 1081947Protein Uncharacterized protein SAV1155 [158370] (1 species)
  7. 1081948Species Staphylococcus aureus [TaxId:1280] [158371] (1 PDB entry)
    Uniprot Q99UV2 52-109
  8. 1081952Domain d2nojh1: 2noj H:52-109 [148331]
    Other proteins in same PDB: d2noja_, d2nojc_, d2noje_, d2nojg_
    automatically matched to 2NOJ B:52-109

Details for d2nojh1

PDB Entry: 2noj (more details), 2.7 Å

PDB Description: crystal structure of ehp / c3d complex
PDB Compounds: (H:) Efb homologous protein

SCOPe Domain Sequences for d2nojh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nojh1 a.7.17.1 (H:52-109) Uncharacterized protein SAV1155 {Staphylococcus aureus [TaxId: 1280]}
nkkvvdaqkavelfkrtrtvathrkaqravnlihfqhsyekkklqrqidlvlkyntlk

SCOPe Domain Coordinates for d2nojh1:

Click to download the PDB-style file with coordinates for d2nojh1.
(The format of our PDB-style files is described here.)

Timeline for d2nojh1: