| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.348: YegP-like [160112] (1 superfamily) comprises two subunits or tandem repeats of beta(3)-alpha-beta motifs; these assemble with the formation of a single beta-sheet and swapping of the C-terminal strands |
Superfamily d.348.1: YegP-like [160113] (2 families) ![]() |
| Family d.348.1.1: YegP-like [160114] (4 proteins) Pfam PF07411; DUF1508 |
| Protein Uncharacterized protein Atu0232 [160115] (1 species) homodimer |
| Species Agrobacterium tumefaciens [TaxId:358] [160116] (1 PDB entry) Uniprot Q8UIR1 1-62 |
| Domain d2k7ia1: 2k7i A:1-62 [148278] |
PDB Entry: 2k7i (more details)
SCOPe Domain Sequences for d2k7ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k7ia1 d.348.1.1 (A:1-62) Uncharacterized protein Atu0232 {Agrobacterium tumefaciens [TaxId: 358]}
mykfeiyqdkageyrfrfkasngetmfssegykakasaihaiesikrnsagadtvdlttm
ta
Timeline for d2k7ia1: