SCOPe 2.08: Domain d2k7ib1: 2k7i B:1-62

Lineage for d2k7ib1 (2k7i B:1-62)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.348: YegP-like [160112] (1 superfamily)
   comprises two subunits or tandem repeats of beta(3)-alpha-beta motifs; these assemble with the formation of a single beta-sheet and swapping of the C-terminal strands

4. Superfamily d.348.1: YegP-like [160113] (2 families)

5. Family d.348.1.1: YegP-like [160114] (4 proteins)
   Pfam PF07411; DUF1508

6. Protein Uncharacterized protein Atu0232 [160115] (1 species)
   homodimer

7. Species Agrobacterium tumefaciens [TaxId:358] [160116] (1 PDB entry)
   Uniprot Q8UIR1 1-62

8. Domain d2k7ib1: 2k7i B:1-62 [148279]
   automatically matched to 2K7I A:1-62

Details for d2k7ib1

PDB Entry: 2k7i

PDB Description: solution nmr structure of protein atu0232 from agrobacterium tumefaciens. northeast structural genomics consortium (nesg) target att3. ontario center for structural proteomics target atc0223.

PDB Compounds: (B:) UPF0339 protein Atu0232

SCOPe Domain Sequences for d2k7ib1:

Sequence; same for both SEQRES and ATOM records:

>d2k7ib1 d.348.1.1 (B:1-62) Uncharacterized protein Atu0232 {Agrobacterium tumefaciens [TaxId: 358]}
mykfeiyqdkageyrfrfkasngetmfssegykakasaihaiesikrnsagadtvdlttm
ta

Timeline for d2k7ib1:

• d2k7ib1 first appeared in SCOP 1.75
  
• d2k7ib1 appears in SCOPe 2.07