Lineage for d2jzob_ (2jzo B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491178Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2491179Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) (S)
    active dimer is formed by strand 5 swapping
  5. 2491180Family c.54.1.1: EIIA-man component-like [53063] (2 proteins)
  6. 2491181Protein IIA domain of mannose transporter, IIA-Man [53064] (1 species)
  7. 2491182Species Escherichia coli [TaxId:562] [53065] (4 PDB entries)
  8. 2491189Domain d2jzob_: 2jzo B: [148248]
    Other proteins in same PDB: d2jzod_
    automated match to d1pdoa_

Details for d2jzob_

PDB Entry: 2jzo (more details)

PDB Description: solution nmr structure of the non-productive complex between iiamannose and iibmannose of the mannose transporter of the e. coli phosphotransferase system
PDB Compounds: (B:) PTS system mannose-specific EIIAB component

SCOPe Domain Sequences for d2jzob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jzob_ c.54.1.1 (B:) IIA domain of mannose transporter, IIA-Man {Escherichia coli [TaxId: 562]}
tiaivigthgwaaeqllktaemllgeqenvgwidfvpgenaetliekynaqlakldttkg
vlflvdtwggspfnaasrivvdkehyeviagvnipmlvetlmardddpsfdelvalavet
gregvkalk

SCOPe Domain Coordinates for d2jzob_:

Click to download the PDB-style file with coordinates for d2jzob_.
(The format of our PDB-style files is described here.)

Timeline for d2jzob_: