SCOPe 2.01: Domain d2jzob1: 2jzo B:2-130

Lineage for d2jzob1 (2jzo B:2-130)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families)
   active dimer is formed by strand 5 swapping

5. Family c.54.1.1: EIIA-man component-like [53063] (2 proteins)

6. Protein IIA domain of mannose transporter, IIA-Man [53064] (1 species)

7. Species Escherichia coli [TaxId:562] [53065] (4 PDB entries)

8. Domain d2jzob1: 2jzo B:2-130 [148248]
   automatically matched to d1pdoa_

Details for d2jzob1

PDB Entry: 2jzo

PDB Description: solution nmr structure of the non-productive complex between iiamannose and iibmannose of the mannose transporter of the e. coli phosphotransferase system

PDB Compounds: (B:) PTS system mannose-specific EIIAB component

SCOPe Domain Sequences for d2jzob1:

Sequence; same for both SEQRES and ATOM records:

>d2jzob1 c.54.1.1 (B:2-130) IIA domain of mannose transporter, IIA-Man {Escherichia coli [TaxId: 562]}
tiaivigthgwaaeqllktaemllgeqenvgwidfvpgenaetliekynaqlakldttkg
vlflvdtwggspfnaasrivvdkehyeviagvnipmlvetlmardddpsfdelvalavet
gregvkalk

Timeline for d2jzob1:

• d2jzob1 first appeared in SCOP 1.75
  
• d2jzob1 appears in SCOPe 2.02
  
• d2jzob1 appears in the current release, SCOPe 2.08, called d2jzob_