SCOPe 2.01: Domain d2jxmb1: 2jxm B:1-246

Lineage for d2jxmb1 (2jxm B:1-246)

1. Root: SCOPe 2.01

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.4: Electron transport chains [58146] (1 superfamily)

4. Superfamily i.4.1: Electron transport chains [58147] (1 family)

5. Family i.4.1.1: Electron transport chains [58148] (3 proteins)
   not a true family

6. Protein Cytochrome f-plastocyanin complex [58149] (2 species)

7. Species Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId:1223] [161284] (1 PDB entry)

8. Domain d2jxmb1: 2jxm B:1-246 [148236]
   Other proteins in same PDB: d2jxma1
   automatically matched to d2pcfb_
   complexed with cu, hec

Details for d2jxmb1

PDB Entry: 2jxm

PDB Description: ensemble of twenty structures of the prochlorothrix hollandica plastocyanin- cytochrome f complex

PDB Compounds: (B:) cytochrome f

SCOPe Domain Sequences for d2jxmb1:

Sequence; same for both SEQRES and ATOM records:

>d2jxmb1 i.4.1.1 (B:1-246) Cytochrome f-plastocyanin complex {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]}
ypfyaqynydspreatgkivcanchlakktveievpqavlpdtvfkavvkvpydldiqqv
qadgspsglnvgavlmlpegfklappervdeelmeevgdfyylvtpysetdenillagpl
pgedyqemifpilspnpatdagvyfgkysihlggnrgrgqvyptgelsnnnafsasiagt
iaaiedngfgfdvtiqpedgdavvtsilpgpelivavgdtveagqllttnpnvggfgqmd
seivlq

Timeline for d2jxmb1:

• d2jxmb1 first appeared in SCOP 1.75
  
• d2jxmb1 appears in SCOPe 2.02
  
• d2jxmb1 appears in the current release, SCOPe 2.08