![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.4: Electron transport chains [58146] (1 superfamily) |
![]() | Superfamily i.4.1: Electron transport chains [58147] (1 family) ![]() |
![]() | Family i.4.1.1: Electron transport chains [58148] (3 proteins) not a true family |
![]() | Protein Cytochrome f-plastocyanin complex [58149] (2 species) |
![]() | Species Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId:1223] [161284] (1 PDB entry) |
![]() | Domain d2jxmb1: 2jxm B:1-246 [148236] Other proteins in same PDB: d2jxma1 automatically matched to d2pcfb_ complexed with cu, hec |
PDB Entry: 2jxm (more details)
SCOPe Domain Sequences for d2jxmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jxmb1 i.4.1.1 (B:1-246) Cytochrome f-plastocyanin complex {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} ypfyaqynydspreatgkivcanchlakktveievpqavlpdtvfkavvkvpydldiqqv qadgspsglnvgavlmlpegfklappervdeelmeevgdfyylvtpysetdenillagpl pgedyqemifpilspnpatdagvyfgkysihlggnrgrgqvyptgelsnnnafsasiagt iaaiedngfgfdvtiqpedgdavvtsilpgpelivavgdtveagqllttnpnvggfgqmd seivlq
Timeline for d2jxmb1: