Lineage for d2ju0a_ (2ju0 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323718Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2324179Protein Frequenin (neuronal calcium sensor 1) [47535] (3 species)
  7. 2324180Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47536] (2 PDB entries)
  8. 2324182Domain d2ju0a_: 2ju0 A: [148208]
    automated match to d1fpwa_
    complexed with ca

Details for d2ju0a_

PDB Entry: 2ju0 (more details)

PDB Description: structure of yeast frequenin bound to pdtins 4-kinase
PDB Compounds: (A:) calcium-binding protein ncs-1

SCOPe Domain Sequences for d2ju0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ju0a_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aktsklskddltclkqstyfdrreiqqwhkgflrdcpsgqlaredfvkiykqffpfgspe
dfanhlftvfdkdnngfihfeefitvlsttsrgtleeklswafelydlnhdgyitfdeml
tivasvykmmgsmvtlnedeatpemrvkkifklmdknedgyitldefregskvdp

SCOPe Domain Coordinates for d2ju0a_:

Click to download the PDB-style file with coordinates for d2ju0a_.
(The format of our PDB-style files is described here.)

Timeline for d2ju0a_: