Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Frequenin (neuronal calcium sensor 1) [47535] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47536] (2 PDB entries) |
Domain d2ju0a1: 2ju0 A:3-177 [148208] automatically matched to d1fpwa_ complexed with ca |
PDB Entry: 2ju0 (more details)
SCOPe Domain Sequences for d2ju0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ju0a1 a.39.1.5 (A:3-177) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} aktsklskddltclkqstyfdrreiqqwhkgflrdcpsgqlaredfvkiykqffpfgspe dfanhlftvfdkdnngfihfeefitvlsttsrgtleeklswafelydlnhdgyitfdeml tivasvykmmgsmvtlnedeatpemrvkkifklmdknedgyitldefregskvdp
Timeline for d2ju0a1: