SCOP 1.75: Domain d2jrxb1: 2jrx B:1-75

Lineage for d2jrxb1 (2jrx B:1-75)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.284: YejL-like [158650] (1 superfamily)
   6 helices; intertwined homodimer of three-helical subunits, bundle

4. Superfamily a.284.1: YejL-like [158651] (1 family)

5. Family a.284.1.1: YejL-like [158652] (5 proteins)
   Pfam PF07208; DUF1414

6. Protein Uncharacterized protein YejL [158659] (1 species)

7. Species Escherichia coli [TaxId:562] [158660] (1 PDB entry)
   Uniprot P0AD24 1-75

8. Domain d2jrxb1: 2jrx B:1-75 [148188]
   automatically matched to 2JRX A:1-75

Details for d2jrxb1

PDB Entry: 2jrx

PDB Description: solution nmr structure of protein yejl from e. coli. northeast structural genomics target er309

PDB Compounds: (B:) UPF0352 protein yejL

SCOP Domain Sequences for d2jrxb1:

Sequence; same for both SEQRES and ATOM records:

>d2jrxb1 a.284.1.1 (B:1-75) Uncharacterized protein YejL {Escherichia coli [TaxId: 562]}
mpqisrysdeqveqllaellnvlekhkaptdlslmvlgnmvtnlintsiapaqrqaians
faralqssinedkah

Timeline for d2jrxb1:

• d2jrxb1 is new in SCOP 1.75
  
• d2jrxb1 appears in SCOPe 2.01
  
• d2jrxb1 appears in the current release, SCOPe 2.08, called d2jrxb2