![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.284: YejL-like [158650] (1 superfamily) 6 helices; intertwined homodimer of three-helical subunits, bundle |
![]() | Superfamily a.284.1: YejL-like [158651] (1 family) ![]() |
![]() | Family a.284.1.1: YejL-like [158652] (5 proteins) Pfam PF07208; DUF1414 |
![]() | Protein Uncharacterized protein YejL [158659] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [158660] (1 PDB entry) Uniprot P0AD24 1-75 |
![]() | Domain d2jrxb2: 2jrx B:1-75 [148188] Other proteins in same PDB: d2jrxa2, d2jrxb3 automated match to d2jrxa1 |
PDB Entry: 2jrx (more details)
SCOPe Domain Sequences for d2jrxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jrxb2 a.284.1.1 (B:1-75) Uncharacterized protein YejL {Escherichia coli [TaxId: 562]} mpqisrysdeqveqllaellnvlekhkaptdlslmvlgnmvtnlintsiapaqrqaians faralqssinedkah
Timeline for d2jrxb2: