SCOPe 2.07: Domain d2jova1: 2jov A:1-77

Lineage for d2jova1 (2jov A:1-77)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.349: CPE0013-like [160147] (1 superfamily)
   beta(2)-alpha-beta(3); mixed, mostly antiparallel beta-sheet, folded in a half-barrel; order:31254; strand 3 is parallel to strand 1 and is shorter than the rest

4. Superfamily d.349.1: CPE0013-like [160148] (1 family)
   automatically mapped to Pfam PF07892

5. Family d.349.1.1: CPE0013-like [160149] (1 protein)
   Pfam PF07892; DUF1667; the founding protein lacks the predicted metal-binding motif, found at the N-termini of other members of the Pfam family

6. Protein Hypothetical protein CPE0013 [160150] (1 species)

7. Species Clostridium perfringens [TaxId:1502] [160151] (1 PDB entry)
   Uniprot Q8XPF0 1-77

8. Domain d2jova1: 2jov A:1-77 [148162]
   Other proteins in same PDB: d2jova2

Details for d2jova1

PDB Entry: 2jov

PDB Description: nmr structure of clostridium perfringens protein cpe0013. northeast structural genomics target cpr31.

PDB Compounds: (A:) Hypothetical protein CPE0013

SCOPe Domain Sequences for d2jova1:

Sequence; same for both SEQRES and ATOM records:

>d2jova1 d.349.1.1 (A:1-77) Hypothetical protein CPE0013 {Clostridium perfringens [TaxId: 1502]}
mhkdiftsvvrvrgskkynvvpvksnkpveiskwidfsnvlsrlyvgvptksgnvvckni
mntgvdiictknlpkds

Timeline for d2jova1:

• d2jova1 first appeared in SCOP 1.75
  
• d2jova1 appears in SCOPe 2.06
  
• d2jova1 appears in the current release, SCOPe 2.08