Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.349: CPE0013-like [160147] (1 superfamily) beta(2)-alpha-beta(3); mixed, mostly antiparallel beta-sheet, folded in a half-barrel; order:31254; strand 3 is parallel to strand 1 and is shorter than the rest |
Superfamily d.349.1: CPE0013-like [160148] (1 family) automatically mapped to Pfam PF07892 |
Family d.349.1.1: CPE0013-like [160149] (1 protein) Pfam PF07892; DUF1667; the founding protein lacks the predicted metal-binding motif, found at the N-termini of other members of the Pfam family |
Protein Hypothetical protein CPE0013 [160150] (1 species) |
Species Clostridium perfringens [TaxId:1502] [160151] (1 PDB entry) Uniprot Q8XPF0 1-77 |
Domain d2jova1: 2jov A:1-77 [148162] Other proteins in same PDB: d2jova2 |
PDB Entry: 2jov (more details)
SCOPe Domain Sequences for d2jova1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jova1 d.349.1.1 (A:1-77) Hypothetical protein CPE0013 {Clostridium perfringens [TaxId: 1502]} mhkdiftsvvrvrgskkynvvpvksnkpveiskwidfsnvlsrlyvgvptksgnvvckni mntgvdiictknlpkds
Timeline for d2jova1: