![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) ![]() |
![]() | Family c.52.1.20: XPF/Rad1/Mus81 nuclease [89716] (3 proteins) |
![]() | Protein DNA excision repair protein ERCC-1 [142445] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142446] (3 PDB entries) Uniprot P07992 99-227 |
![]() | Domain d2jnwa1: 2jnw A:99-214 [148152] automatically matched to d2a1ia1 |
PDB Entry: 2jnw (more details)
SCOPe Domain Sequences for d2jnwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jnwa1 c.52.1.20 (A:99-214) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]} nsiivsprqrgnpvlkfvrnvpwefgdvipdyvlgqstcalflslryhnlhpdyihgrlq slgknfalrvllvqvdvkdpqqalkelakmciladctlilawspeeagryletyka
Timeline for d2jnwa1: