Lineage for d2jnwa1 (2jnw A:99-214)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1170597Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1170598Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 1170882Family c.52.1.20: XPF/Rad1/Mus81 nuclease [89716] (3 proteins)
  6. 1170883Protein DNA excision repair protein ERCC-1 [142445] (1 species)
  7. 1170884Species Human (Homo sapiens) [TaxId:9606] [142446] (3 PDB entries)
    Uniprot P07992 99-227
  8. 1170887Domain d2jnwa1: 2jnw A:99-214 [148152]
    automatically matched to d2a1ia1

Details for d2jnwa1

PDB Entry: 2jnw (more details)

PDB Description: solution structure of a ercc1-xpa heterodimer
PDB Compounds: (A:) DNA excision repair protein ERCC-1

SCOPe Domain Sequences for d2jnwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jnwa1 c.52.1.20 (A:99-214) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]}
nsiivsprqrgnpvlkfvrnvpwefgdvipdyvlgqstcalflslryhnlhpdyihgrlq
slgknfalrvllvqvdvkdpqqalkelakmciladctlilawspeeagryletyka

SCOPe Domain Coordinates for d2jnwa1:

Click to download the PDB-style file with coordinates for d2jnwa1.
(The format of our PDB-style files is described here.)

Timeline for d2jnwa1: