Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.3: L30e-like [55315] (3 families) |
Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) |
Protein Spliceosomal 15.5kd protein [55321] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55322] (3 PDB entries) |
Domain d2jnba1: 2jnb A:4-128 [148148] automatically matched to d1e7ka_ |
PDB Entry: 2jnb (more details)
SCOPe Domain Sequences for d2jnba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jnba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]} advnpkaypladahltkklldlvqqscnykqlrkganeatktlnrgisefivmaadaepl eiilhlpllcedknvpyvfvrskqalgracgvsrpviacsvtikegsqlkqqiqsiqqsi erllv
Timeline for d2jnba1: