SCOPe 2.08: Domain d2jiqa1: 2jiq A:601-723

Lineage for d2jiqa1 (2jiq A:601-723)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.0: automated matches [191648] (1 protein)
   not a true family

6. Protein automated matches [191195] (10 species)
   not a true protein

7. Species Desulfovibrio desulfuricans [TaxId:876] [255266] (3 PDB entries)

8. Domain d2jiqa1: 2jiq A:601-723 [148097]
   Other proteins in same PDB: d2jiqa2
   automated match to d2v3va1
   complexed with mgd, mo, no2, no3, sf4, unx

Details for d2jiqa1

PDB Entry: 2jiq, 2.44 Å

PDB Description: a new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand

PDB Compounds: (A:) periplasmic nitrate reductase

SCOPe Domain Sequences for d2jiqa1:

Sequence; same for both SEQRES and ATOM records:

>d2jiqa1 b.52.2.0 (A:601-723) automated matches {Desulfovibrio desulfuricans [TaxId: 876]}
aaeepdaeyplyltsmrvidhwhtatmtgkvpelqkanpiafveineedaartgikhgds
vivetrrdamelparvsdvcrpgliavpffdpkklvnklfldatdpvsrepeykicaarv
rka

Timeline for d2jiqa1:

• d2jiqa1 first appeared in SCOP 1.75
  
• d2jiqa1 appears in SCOPe 2.07