Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
Protein Oxalyl-CoA decarboxylase [142124] (1 species) |
Species Oxalobacter formigenes [TaxId:847] [142125] (6 PDB entries) Uniprot P40149 195-369 |
Domain d2jibb1: 2jib B:195-369 [148083] Other proteins in same PDB: d2jiba2, d2jiba3, d2jibb2, d2jibb3 automatically matched to d2c31a1 complexed with adp, coa, mg, pge, tpp |
PDB Entry: 2jib (more details), 2.2 Å
SCOP Domain Sequences for d2jibb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jibb1 c.31.1.3 (B:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} aqipaedaiaraadliknakrpvimlgkgaayaqcddeiralveetgipflpmgmakgll pdnhpqsaaatrafalaqcdvcvligarlnwlmqhgkgktwgdelkkyvqidiqanemds nqpiaapvvgdiksavsllrkalkgapkadaewtgalkakvdgnkaklagkmtae
Timeline for d2jibb1: