![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (1 family) ![]() |
![]() | Family b.22.1.1: TNF-like [49843] (14 proteins) |
![]() | Protein Complement c1q globular head, A chain [101613] (1 species) hetrotrimer of A, B and C chains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101614] (3 PDB entries) |
![]() | Domain d2jg8d1: 2jg8 D:90-222 [148042] Other proteins in same PDB: d2jg8b1, d2jg8c1, d2jg8e1, d2jg8f1 automatically matched to d1pk6a_ complexed with ca, nag |
PDB Entry: 2jg8 (more details), 2.05 Å
SCOP Domain Sequences for d2jg8d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jg8d1 b.22.1.1 (D:90-222) Complement c1q globular head, A chain {Human (Homo sapiens) [TaxId: 9606]} qprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwei clsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgse adsvfsgflifps
Timeline for d2jg8d1: