Lineage for d2jg8a1 (2jg8 A:90-222)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 793598Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 793599Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 793600Family b.22.1.1: TNF-like [49843] (14 proteins)
  6. 793646Protein Complement c1q globular head, A chain [101613] (1 species)
    hetrotrimer of A, B and C chains
  7. 793647Species Human (Homo sapiens) [TaxId:9606] [101614] (3 PDB entries)
  8. 793649Domain d2jg8a1: 2jg8 A:90-222 [148039]
    Other proteins in same PDB: d2jg8b1, d2jg8c1, d2jg8e1, d2jg8f1
    automatically matched to d1pk6a_
    complexed with ca, nag

Details for d2jg8a1

PDB Entry: 2jg8 (more details), 2.05 Å

PDB Description: crystallographic structure of human c1q globular heads complexed to phosphatidyl-serine
PDB Compounds: (A:) complement c1q subcomponent subunit a

SCOP Domain Sequences for d2jg8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jg8a1 b.22.1.1 (A:90-222) Complement c1q globular head, A chain {Human (Homo sapiens) [TaxId: 9606]}
qprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwei
clsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgse
adsvfsgflifps

SCOP Domain Coordinates for d2jg8a1:

Click to download the PDB-style file with coordinates for d2jg8a1.
(The format of our PDB-style files is described here.)

Timeline for d2jg8a1: