SCOP 1.75: Domain d2jera1: 2jer A:2-365

Lineage for d2jera1 (2jer A:2-365)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
   duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis

4. Superfamily d.126.1: Pentein [55909] (7 families)

5. Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (2 proteins)
   Pfam PF04371; functionally related to the amidinotransferase, similar active site

6. Protein Agmatine iminohydrolase [111156] (3 species)

7. Species Enterococcus faecalis [TaxId:1351] [160717] (1 PDB entry)
   Uniprot Q837U5 2-365

8. Domain d2jera1: 2jer A:2-365 [148019]
   complexed with agt, arg, gln, glu, gly, ile, lys, pro, thr, val

Details for d2jera1

PDB Entry: 2jer, 1.65 Å

PDB Description: agmatine deiminase of enterococcus faecalis catalyzing its reaction.

PDB Compounds: (A:) agmatine deiminase

SCOP Domain Sequences for d2jera1:

Sequence; same for both SEQRES and ATOM records:

>d2jera1 d.126.1.6 (A:2-365) Agmatine iminohydrolase {Enterococcus faecalis [TaxId: 1351]}
akrivgstpkqdgfrmpgefepqekvwmiwperpdnwrdggkpvqeaftnvakaisqftp
mnvvvsqqqfqncrrqlppeitvyemsnndawvrdcgpsfvindhgeirgvdwtfnawgg
lvdglyfpwdqddlvaqkiceiehvdsyrtddfvleggsfhvdgqgtvlttemcllsegr
npqlskeaieqklcdylnvekvlwlgdgidpeetnghvddvacfiapgevaciytedqns
pfyeaaqdayqrllkmtdakgrqlkvhklccpvknvtikgsfkidfvegtmpredgdici
asymnflitndgvivpqygdendrlaleqvqtmfpdkkivgvntvevvygggnihxitqq
epkr

Timeline for d2jera1:

• d2jera1 is new in SCOP 1.75
  
• d2jera1 appears in SCOPe 2.01
  
• d2jera1 appears in the current release, SCOPe 2.08