Lineage for d2jdka_ (2jdk A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430565Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 2430566Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) (S)
  5. 2430567Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)
    automatically mapped to Pfam PF07472
  6. 2430617Protein automated matches [190094] (4 species)
    not a true protein
  7. 2430651Species Pseudomonas aeruginosa [TaxId:287] [186815] (12 PDB entries)
  8. 2430656Domain d2jdka_: 2jdk A: [147983]
    automated match to d1gzta_
    complexed with ca, fuc, so4, t45

Details for d2jdka_

PDB Entry: 2jdk (more details), 1.1 Å

PDB Description: lectin pa-iil of p.aeruginosa complexed with disaccharide derivative
PDB Compounds: (A:) Fucose-binding lectin PA-IIL

SCOPe Domain Sequences for d2jdka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jdka_ b.115.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

SCOPe Domain Coordinates for d2jdka_:

Click to download the PDB-style file with coordinates for d2jdka_.
(The format of our PDB-style files is described here.)

Timeline for d2jdka_: