SCOPe 2.08: Domain d2j8cm_: 2j8c M:

Lineage for d2j8cm_ (2j8c M:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (17 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [186985] (34 PDB entries)

8. Domain d2j8cm_: 2j8c M: [147910]
   Other proteins in same PDB: d2j8ch1, d2j8ch2
   automated match to d1ystm_
   complexed with bcl, bph, cdl, fe, ggd, gol, hto, lda, pc1, po4, spo, u10

Details for d2j8cm_

PDB Entry: 2j8c, 1.87 Å

PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 8 in the neutral state

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d2j8cm_:

Sequence; same for both SEQRES and ATOM records:

>d2j8cm_ f.26.1.1 (M:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hgm

Timeline for d2j8cm_:

• d2j8cm_ first appeared in SCOP 1.75, called d2j8cm1
  
• d2j8cm_ appears in SCOPe 2.07