Lineage for d2j4ra2 (2j4r A:133-306)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605874Family c.55.1.8: Ppx/GppA phosphatase [110630] (2 proteins)
    Pfam PF02541
  6. Protein automated matches [254546] (1 species)
    not a true protein
  7. Species Aquifex aeolicus [TaxId:63363] [255249] (1 PDB entry)
  8. 1605899Domain d2j4ra2: 2j4r A:133-306 [147883]
    automated match to d1t6ca2
    complexed with g4p

Details for d2j4ra2

PDB Entry: 2j4r (more details), 2.71 Å

PDB Description: structural study of the aquifex aeolicus ppx-gppa enzyme
PDB Compounds: (A:) exopolyphosphatase

SCOPe Domain Sequences for d2j4ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j4ra2 c.55.1.8 (A:133-306) automated matches {Aquifex aeolicus [TaxId: 63363]}
pegevcvvdqgggsteyvfgkgykvrevislpigivnltetffkqdppteeevkrffefl
ekelskvkkpvdtivglggtittlaaleynvypydpqkvhgkvltygqikkwfdtfkeip
seerskrfrqvedrrakvilagigiflktleifekdclivsdwglregvlvsev

SCOPe Domain Coordinates for d2j4ra2:

Click to download the PDB-style file with coordinates for d2j4ra2.
(The format of our PDB-style files is described here.)

Timeline for d2j4ra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j4ra1