![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.8: Ppx/GppA phosphatase [110630] (2 proteins) Pfam PF02541 |
![]() | Domain d2j4ra1: 2j4r A:7-132 [147882] automated match to d1t6ca1 complexed with g4p |
PDB Entry: 2j4r (more details), 2.71 Å
SCOPe Domain Sequences for d2j4ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j4ra1 c.55.1.8 (A:7-132) automated matches {Aquifex aeolicus [TaxId: 63363]} pimrvasidigsnsvrltiaqikdgklsiilergritslgtkvketgrlqedrieetiqv lkeykklidefkvervkavateairraknaeeflervkrevglvvevitpeqegryayla vayslk
Timeline for d2j4ra1: