![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins) automatically mapped to Pfam PF00135 |
![]() | Protein Acetylcholinesterase [53476] (6 species) |
![]() | Species Pacific electric ray (Torpedo californica) [TaxId:7787] [53477] (98 PDB entries) Uniprot P04058 25-556 |
![]() | Domain d2j3da1: 2j3d A:4-535 [147858] automatically matched to d1evea_ complexed with mg, nag |
PDB Entry: 2j3d (more details), 2.6 Å
SCOPe Domain Sequences for d2j3da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j3da1 c.69.1.1 (A:4-535) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat
Timeline for d2j3da1: