Class b: All beta proteins [48724] (180 folds) |
Fold b.109: beta-hairpin stack [69359] (1 superfamily) Trp-rich beta-hairpin repeat units form helical structures of 3 units per turn |
Superfamily b.109.1: Cell wall binding repeat [69360] (1 family) |
Family b.109.1.1: Cell wall binding repeat [69361] (4 proteins) this is a repeat family; one repeat unit is 2bib A:415-315 found in domain |
Protein automated matches [190222] (3 species) not a true protein |
Domain d2ixua1: 2ixu A:191-339 [147830] Other proteins in same PDB: d2ixua2 automated match to d2j8ga1 complexed with ala, fmt, zgl |
PDB Entry: 2ixu (more details), 2.28 Å
SCOPe Domain Sequences for d2ixua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ixua1 b.109.1.1 (A:191-339) automated matches {Streptococcus phage [TaxId: 10747]} eeddkpktagtwkqdskgwwfrrnngsfpynkwekiggvwyyfdskgycltsewlkdnek wyylkdngamatgwvlvgsewyymddsgamvtgwvkyknnwyymtnergnmvsnefiksg kgwyfmntngeladnpsftkepdglitva
Timeline for d2ixua1: