SCOPe 2.08: Domain d2ixua1: 2ixu A:191-339

Lineage for d2ixua1 (2ixu A:191-339)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.109: beta-hairpin stack [69359] (1 superfamily)
   Trp-rich beta-hairpin repeat units form helical structures of 3 units per turn

4. Superfamily b.109.1: Cell wall binding repeat [69360] (1 family)

5. Family b.109.1.1: Cell wall binding repeat [69361] (4 proteins)
   this is a repeat family; one repeat unit is 2bib A:415-315 found in domain

6. Protein automated matches [190222] (3 species)
   not a true protein

7. Species Streptococcus phage [TaxId:10747] [255247] (2 PDB entries)

8. Domain d2ixua1: 2ixu A:191-339 [147830]
   Other proteins in same PDB: d2ixua2
   automated match to d2j8ga1
   complexed with ala, fmt, zgl

Details for d2ixua1

PDB Entry: 2ixu, 2.28 Å

PDB Description: crystal structure of the modular cpl-1 endolysin complexed with a peptidoglycan analogue (wild-type endolysin)

PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d2ixua1:

Sequence; same for both SEQRES and ATOM records:

>d2ixua1 b.109.1.1 (A:191-339) automated matches {Streptococcus phage [TaxId: 10747]}
eeddkpktagtwkqdskgwwfrrnngsfpynkwekiggvwyyfdskgycltsewlkdnek
wyylkdngamatgwvlvgsewyymddsgamvtgwvkyknnwyymtnergnmvsnefiksg
kgwyfmntngeladnpsftkepdglitva

Timeline for d2ixua1:

• d2ixua1 first appeared in SCOP 1.75
  
• d2ixua1 appears in SCOPe 2.07