Lineage for d2ixua2 (2ixu A:2-190)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.8: 1,4-beta-N-acetylmuraminidase [63912] (4 proteins)
Glycosyl hydrolase family 25; probably have evolved from a type II chitinase ancestor
permutation of the common fold; strand 8 is antiparallel to the rest of the barrel
Protein automated matches [254544] (2 species)
not a true protein- Species Streptococcus phage [TaxId:10747] [255246] (2 PDB entries)
Domain d2ixua2: 2ixu A:2-190 [147831]
Other proteins in same PDB: d2ixua1
automated match to d1h09a2
complexed with ala, fmt, zgl
Details for d2ixua2
PDB Entry: 2ixu (more details), 2.28 Å
PDB Description: crystal structure of the modular cpl-1 endolysin complexed with a peptidoglycan analogue (wild-type endolysin)
PDB Compounds: (A:) lysozymeSCOPe Domain Sequences for d2ixua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ixua2 c.1.8.8 (A:2-190) automated matches {Streptococcus phage [TaxId: 10747]}
vkkndlfvdvsshngyditgileqmgttntiikisesttylnpclsaqveqsnpigfyhf
arfggdvaeaereaqffldnvpmqvkylvldyeddpsgdaqantnaclrfmqmiadagyk
piyysykpfthdnvdyqqilaqfpnslwiagyglndgtanfeyfpsmdgirwwqyssnpf
dknivlldd
SCOPe Domain Coordinates for d2ixua2:
Click to download the PDB-style file with coordinates for d2ixua2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ixua2:
- d2ixua2 first appeared in SCOP 1.75
- d2ixua2 appears in SCOPe 2.07
View in 3D
