Lineage for d2ix1a4 (2ix1 A:173-557)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1789724Family b.40.4.16: RNB domain-like [159112] (3 proteins)
    Pfam PF00773; RNase II catalytic domain; decorated OB-fold domain with extra C-terminal structures forming the active site
  6. 1789725Protein Exoribonuclease 2, RNB [159117] (1 species)
    RNase II
  7. 1789726Species Escherichia coli [TaxId:562] [159118] (3 PDB entries)
    Uniprot P30850 173-557
  8. 1789732Domain d2ix1a4: 2ix1 A:173-557 [147825]
    Other proteins in same PDB: d2ix1a1, d2ix1a2, d2ix1a3
    complexed with mg; mutant

Details for d2ix1a4

PDB Entry: 2ix1 (more details), 2.74 Å

PDB Description: rnase ii d209n mutant
PDB Compounds: (A:) Exoribonuclease 2

SCOPe Domain Sequences for d2ix1a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ix1a4 b.40.4.16 (A:173-557) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]}
eapdgvatemldeglvredltaldfvtidsastedmndalfakalpddklqlivaiadpt
awiaegskldkaakiraftnylpgfnipmlprelsddlcslranevrpvlacrmtlsadg
tiednieffaatieskaklvydqvsdwlentgdwqpeseaiaeqvrllaqicqrrgewrh
nhalvfkdrpdyrfilgekgevldivaeprrianriveeamiaanicaarvlrdklgfgi
ynvhmgfdpanadalaallkthglhvdaeevltldgfcklrreldaqptgfldsrirrfq
sfaeistepgphfglgleayatwtspirkygdminhrllkavikgetatrpqdeitvqma
errrlnrmaerdvgdwlyarflkdk

SCOPe Domain Coordinates for d2ix1a4:

Click to download the PDB-style file with coordinates for d2ix1a4.
(The format of our PDB-style files is described here.)

Timeline for d2ix1a4: