![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) ![]() |
![]() | Family b.40.4.16: RNB domain-like [159112] (3 proteins) Pfam PF00773; RNase II catalytic domain; decorated OB-fold domain with extra C-terminal structures forming the active site |
![]() | Protein Exoribonuclease 2, RNB [159117] (1 species) RNase II |
![]() | Species Escherichia coli [TaxId:562] [159118] (3 PDB entries) Uniprot P30850 173-557 |
![]() | Domain d2ix1a4: 2ix1 A:173-557 [147825] Other proteins in same PDB: d2ix1a1, d2ix1a2, d2ix1a3 complexed with mg; mutant |
PDB Entry: 2ix1 (more details), 2.74 Å
SCOP Domain Sequences for d2ix1a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ix1a4 b.40.4.16 (A:173-557) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} eapdgvatemldeglvredltaldfvtidsastedmndalfakalpddklqlivaiadpt awiaegskldkaakiraftnylpgfnipmlprelsddlcslranevrpvlacrmtlsadg tiednieffaatieskaklvydqvsdwlentgdwqpeseaiaeqvrllaqicqrrgewrh nhalvfkdrpdyrfilgekgevldivaeprrianriveeamiaanicaarvlrdklgfgi ynvhmgfdpanadalaallkthglhvdaeevltldgfcklrreldaqptgfldsrirrfq sfaeistepgphfglgleayatwtspirkygdminhrllkavikgetatrpqdeitvqma errrlnrmaerdvgdwlyarflkdk
Timeline for d2ix1a4: