SCOPe 2.07: Domain d2iqic_: 2iqi C:

Lineage for d2iqic_ (2iqi C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.6: XCC0632-like [159594] (2 families)
   short crossover loop between strands 2 and 3; the antiparallel part of the beta-sheet (strands 3, 4 and 5) and the C-terminal helix are quite long

5. Family c.51.6.2: XCC0632-like [159598] (1 protein)
   Pfam PF03886; DUF330

6. Protein Hypothetical protein XCC0632 [159599] (1 species)

7. Species Xanthomonas campestris pv. campestris [TaxId:340] [159600] (1 PDB entry)
   Uniprot Q8PCT0 32-209

8. Domain d2iqic_: 2iqi C: [147779]
   automated match to d2iqia1

Details for d2iqic_

PDB Entry: 2iqi, 2.7 Å

PDB Description: crystal structure of protein xcc0632 from xanthomonas campestris, pfam duf330

PDB Compounds: (C:) Hypothetical protein XCC0632

SCOPe Domain Sequences for d2iqic_:

Sequence, based on SEQRES records:

>d2iqic_ c.51.6.2 (C:) Hypothetical protein XCC0632 {Xanthomonas campestris pv. campestris [TaxId: 340]}
tiyaptvrvtpnpawpqvswqllvakpsaariidsprinvrptpgelqvyhgagwaqpat
dmledsvvrafedsgkiaavarigagirsdyklaidvrrfesdyagqslpaatielnakl
lhssdqrvvasrtftvarpssstdtaavaaafeqaltqvttelvgwtlitgqqdsqt

Sequence, based on observed residues (ATOM records):

>d2iqic_ c.51.6.2 (C:) Hypothetical protein XCC0632 {Xanthomonas campestris pv. campestris [TaxId: 340]}
tiyaptvrvtpnpawpqvswqllvakpsaariidsprinvrptpgelqvyhgagwaqpat
dmledsvvrafedsgkiaavarsdyklaidvrrfesdyagqslpaatielnakllhssdq
rvvasrtftvarpssstdtaavaaafeqaltqvttelvgwtlitgqqdsqt

Timeline for d2iqic_:

• d2iqic_ first appeared in SCOP 1.75, called d2iqic1
  
• d2iqic_ appears in SCOPe 2.06
  
• d2iqic_ appears in the current release, SCOPe 2.08