![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.98: MurF and HprK N-domain-like [63417] (2 superfamilies) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1234; structural similarity of the MurF and HprK extends beyond the core. |
![]() | Superfamily c.98.2: HprK N-terminal domain-like [75138] (2 families) ![]() probable phosphatase |
![]() | Family c.98.2.2: DRTGG domain [159447] (1 protein) Pfam PF07085 |
![]() | Protein Hypothetical protein AF1212 [159448] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [159449] (1 PDB entry) Uniprot O29056 206-329 |
![]() | Domain d2iojb_: 2ioj B: [147746] automated match to d2ioja1 |
PDB Entry: 2ioj (more details), 2.15 Å
SCOPe Domain Sequences for d2iojb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iojb_ c.98.2.2 (B:) Hypothetical protein AF1212 {Archaeoglobus fulgidus [TaxId: 2234]} glsveeireavsgeyliepreekmveqvvigamspqsalrylrearnaalvtggdrsdll ltalempnvrcliltgnlepvqlvltkaeergvpviltghdtltavsrlesvfgrtrirg
Timeline for d2iojb_: