SCOPe 2.08: Domain d2iojb_: 2ioj B:

Lineage for d2iojb_ (2ioj B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.98: MurF and HprK N-domain-like [63417] (2 superfamilies)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1234; structural similarity of the MurF and HprK extends beyond the core.

4. Superfamily c.98.2: HprK N-terminal domain-like [75138] (2 families)
   probable phosphatase

5. Family c.98.2.2: DRTGG domain [159447] (1 protein)
   Pfam PF07085

6. Protein Hypothetical protein AF1212 [159448] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [159449] (1 PDB entry)
   Uniprot O29056 206-329

8. Domain d2iojb_: 2ioj B: [147746]
   automated match to d2ioja1

Details for d2iojb_

PDB Entry: 2ioj, 2.15 Å

PDB Description: crystal structure of protein af1212 from archaeoglobus fulgidus, pfam drtgg

PDB Compounds: (B:) Hypothetical protein AF_1212

SCOPe Domain Sequences for d2iojb_:

Sequence; same for both SEQRES and ATOM records:

>d2iojb_ c.98.2.2 (B:) Hypothetical protein AF1212 {Archaeoglobus fulgidus [TaxId: 2234]}
glsveeireavsgeyliepreekmveqvvigamspqsalrylrearnaalvtggdrsdll
ltalempnvrcliltgnlepvqlvltkaeergvpviltghdtltavsrlesvfgrtrirg

Timeline for d2iojb_:

• d2iojb_ first appeared in SCOP 1.75, called d2iojb1
  
• d2iojb_ appears in SCOPe 2.07