Lineage for d2ioja1 (2ioj A:206-325)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918983Fold c.98: MurF and HprK N-domain-like [63417] (2 superfamilies)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1234; structural similarity of the MurF and HprK extends beyond the core.
  4. 2919000Superfamily c.98.2: HprK N-terminal domain-like [75138] (2 families) (S)
    probable phosphatase
  5. 2919013Family c.98.2.2: DRTGG domain [159447] (1 protein)
    Pfam PF07085
  6. 2919014Protein Hypothetical protein AF1212 [159448] (1 species)
  7. 2919015Species Archaeoglobus fulgidus [TaxId:2234] [159449] (1 PDB entry)
    Uniprot O29056 206-329
  8. 2919016Domain d2ioja1: 2ioj A:206-325 [147745]

Details for d2ioja1

PDB Entry: 2ioj (more details), 2.15 Å

PDB Description: crystal structure of protein af1212 from archaeoglobus fulgidus, pfam drtgg
PDB Compounds: (A:) Hypothetical protein AF_1212

SCOPe Domain Sequences for d2ioja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ioja1 c.98.2.2 (A:206-325) Hypothetical protein AF1212 {Archaeoglobus fulgidus [TaxId: 2234]}
glsveeireavsgeyliepreekmveqvvigamspqsalrylrearnaalvtggdrsdll
ltalempnvrcliltgnlepvqlvltkaeergvpviltghdtltavsrlesvfgrtrirg

SCOPe Domain Coordinates for d2ioja1:

Click to download the PDB-style file with coordinates for d2ioja1.
(The format of our PDB-style files is described here.)

Timeline for d2ioja1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2iojb_