Lineage for d2imjd_ (2imj D:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1019632Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1020039Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1020584Family d.17.4.23: PFL3262-like [160018] (1 protein)
    Pfam PF07080; DUF1348
  6. 1020585Protein Hypothetical protein PFL3262 [160019] (1 species)
  7. 1020586Species Pseudomonas fluorescens [TaxId:294] [160020] (1 PDB entry)
    Uniprot Q4KBL6 5-159
  8. 1020590Domain d2imjd_: 2imj D: [147728]
    automated match to d2imja1
    complexed with act, edo

Details for d2imjd_

PDB Entry: 2imj (more details), 1.5 Å

PDB Description: x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14.
PDB Compounds: (D:) Hypothetical protein DUF1348

SCOPe Domain Sequences for d2imjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2imjd_ d.17.4.23 (D:) Hypothetical protein PFL3262 {Pseudomonas fluorescens [TaxId: 294]}
naqvrpplppftresaiekirlaedgwnsrdpervslaytldtqwrnraefahnreeaka
fltrkwakeldyrlikelwaftdnriavryayewhddsgnwfrsygnenwefdeqglmar
rfacindmpikaqerkfhwplgrrpddhpglse

SCOPe Domain Coordinates for d2imjd_:

Click to download the PDB-style file with coordinates for d2imjd_.
(The format of our PDB-style files is described here.)

Timeline for d2imjd_: