Lineage for d2iija1 (2iij A:1-156)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1112427Superfamily b.1.22: ASF1-like [101546] (1 family) (S)
    contains extra C-terminal strand
  5. 1112428Family b.1.22.1: ASF1-like [101547] (2 proteins)
  6. 1112429Protein Anti-silencing protein 1, ASF1 [101548] (3 species)
  7. 1112448Species Human (Homo sapiens) [TaxId:9606] [158910] (4 PDB entries)
    Uniprot Q6IA08 1-154! Uniprot Q9Y294 1-154! Uniprot Q9Y294 1-156
  8. 1112453Domain d2iija1: 2iij A:1-156 [147709]

Details for d2iija1

PDB Entry: 2iij (more details)

PDB Description: structure of human asf1a in complex with histone h3
PDB Compounds: (A:) ASF1A protein

SCOPe Domain Sequences for d2iija1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iija1 b.1.22.1 (A:1-156) Anti-silencing protein 1, ASF1 {Human (Homo sapiens) [TaxId: 9606]}
makvqvnnvvvldnpspfynpfqfeitfeciedlsedlewkiiyvgsaeseeydqvldsv
lvgpvpagrhmfvfqadapnpglipdadavgvtvvlitctyrgqefirvgyyvnneytet
elrenppvkpdfsklqrnilasnprvtrfhinwedn

SCOPe Domain Coordinates for d2iija1:

Click to download the PDB-style file with coordinates for d2iija1.
(The format of our PDB-style files is described here.)

Timeline for d2iija1: