| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) ![]() consists of one domain of this fold |
| Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
| Protein Oligoribonuclease [89719] (2 species) |
| Species Escherichia coli [TaxId:562] [142492] (2 PDB entries) Uniprot P0A784 1-180 |
| Domain d2igib_: 2igi B: [147658] automated match to d1ytaa1 complexed with acy, cd, zn |
PDB Entry: 2igi (more details), 1.7 Å
SCOPe Domain Sequences for d2igib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2igib_ c.55.3.5 (B:) Oligoribonuclease {Escherichia coli [TaxId: 562]}
anennliwidlemtgldperdriieiatlvtdanlnilaegptiavhqsdeqlalmddwn
vrthtasglvervkastmgdreaelatleflkqwvpagkspicgnsigqdrrflfkympe
leayfhyryldvstlkelarrwkpeildgftkqgthqamddiresvaelayyrehfikl
Timeline for d2igib_: