Lineage for d2igia_ (2igi A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1373755Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1374321Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 1374591Protein Oligoribonuclease [89719] (2 species)
  7. 1374592Species Escherichia coli [TaxId:562] [142492] (2 PDB entries)
    Uniprot P0A784 1-180
  8. 1374593Domain d2igia_: 2igi A: [147657]
    automated match to d1ytaa1
    complexed with acy, cd, zn

Details for d2igia_

PDB Entry: 2igi (more details), 1.7 Å

PDB Description: Crystal Structure of E. coli Oligoribonuclease
PDB Compounds: (A:) Oligoribonuclease

SCOPe Domain Sequences for d2igia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2igia_ c.55.3.5 (A:) Oligoribonuclease {Escherichia coli [TaxId: 562]}
sanennliwidlemtgldperdriieiatlvtdanlnilaegptiavhqsdeqlalmddw
nvrthtasglvervkastmgdreaelatleflkqwvpagkspicgnsigqdrrflfkymp
eleayfhyryldvstlkelarrwkpeildgftkqgthqamddiresvaelayyrehfikl

SCOPe Domain Coordinates for d2igia_:

Click to download the PDB-style file with coordinates for d2igia_.
(The format of our PDB-style files is described here.)

Timeline for d2igia_: