SCOP 1.75: Domain d2igia1: 2igi A:1-180

Lineage for d2igia1 (2igi A:1-180)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (14 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (15 proteins)
   contains Pfam PF00929

6. Protein Oligoribonuclease [89719] (2 species)

7. Species Escherichia coli [TaxId:562] [142492] (2 PDB entries)
   Uniprot P0A784 1-180

8. Domain d2igia1: 2igi A:1-180 [147657]
   automatically matched to d1ytaa1
   complexed with acy, cd, zn

Details for d2igia1

PDB Entry: 2igi, 1.7 Å

PDB Description: Crystal Structure of E. coli Oligoribonuclease

PDB Compounds: (A:) Oligoribonuclease

SCOP Domain Sequences for d2igia1:

Sequence; same for both SEQRES and ATOM records:

>d2igia1 c.55.3.5 (A:1-180) Oligoribonuclease {Escherichia coli [TaxId: 562]}
sanennliwidlemtgldperdriieiatlvtdanlnilaegptiavhqsdeqlalmddw
nvrthtasglvervkastmgdreaelatleflkqwvpagkspicgnsigqdrrflfkymp
eleayfhyryldvstlkelarrwkpeildgftkqgthqamddiresvaelayyrehfikl

Timeline for d2igia1:

• d2igia1 is new in SCOP 1.75
  
• d2igia1 is called d2igia_ in SCOPe 2.01
  
• d2igia1 appears in the current release, SCOPe 2.08, called d2igia_