Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (14 families) consists of one domain of this fold |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (15 proteins) contains Pfam PF00929 |
Protein Oligoribonuclease [89719] (2 species) |
Species Escherichia coli [TaxId:562] [142492] (2 PDB entries) Uniprot P0A784 1-180 |
Domain d2igia1: 2igi A:1-180 [147657] automatically matched to d1ytaa1 complexed with acy, cd, zn |
PDB Entry: 2igi (more details), 1.7 Å
SCOP Domain Sequences for d2igia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2igia1 c.55.3.5 (A:1-180) Oligoribonuclease {Escherichia coli [TaxId: 562]} sanennliwidlemtgldperdriieiatlvtdanlnilaegptiavhqsdeqlalmddw nvrthtasglvervkastmgdreaelatleflkqwvpagkspicgnsigqdrrflfkymp eleayfhyryldvstlkelarrwkpeildgftkqgthqamddiresvaelayyrehfikl
Timeline for d2igia1: