SCOPe 2.08: Domain d2iaya1: 2iay A:1-113

Lineage for d2iaya1 (2iay A:1-113)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.376: Lp2179-like [160799] (1 superfamily)
   beta(2)-alpha-beta(4)-alpha-beta; contains two antiparallel beta-sheets (orders: 127 and 3456) packed against the longer C-terminal helix

4. Superfamily d.376.1: Lp2179-like [160800] (1 family)
   automatically mapped to Pfam PF08866

5. Family d.376.1.1: Lp2179-like [160801] (1 protein)
   Pfam PF08866, DUF1831

6. Protein Hypothetical protein Lp2179 [160802] (1 species)

7. Species Lactobacillus plantarum [TaxId:1590] [160803] (1 PDB entry)
   Uniprot Q88V95 1-113

8. Domain d2iaya1: 2iay A:1-113 [147592]
   Other proteins in same PDB: d2iaya2
   complexed with cl, gol

Details for d2iaya1

PDB Entry: 2iay, 1.2 Å

PDB Description: crystal structure of a duf1831 family protein (lp2179) from lactobacillus plantarum at 1.20 a resolution

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2iaya1:

Sequence; same for both SEQRES and ATOM records:

>d2iaya1 d.376.1.1 (A:1-113) Hypothetical protein Lp2179 {Lactobacillus plantarum [TaxId: 1590]}
maytttvkldgdtktytlsptvkkytlmdlgfvkgrsgafsfersldptspyqaafklkm
tvnadltgfkmttvtgngvqranifkndahpeaveqlryilanfierdilttd

Timeline for d2iaya1:

• d2iaya1 first appeared in SCOP 1.75
  
• d2iaya1 appears in SCOPe 2.07