Lineage for d2iaya1 (2iay A:1-113)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 883097Fold d.376: Lp2179-like [160799] (1 superfamily)
    beta(2)-alpha-beta(4)-alpha-beta; contains two antiparallel beta-sheets (orders: 127 and 3456) packed against the longer C-terminal helix
  4. 883098Superfamily d.376.1: Lp2179-like [160800] (1 family) (S)
  5. 883099Family d.376.1.1: Lp2179-like [160801] (1 protein)
    Pfam PF08866, DUF1831
  6. 883100Protein Hypothetical protein Lp2179 [160802] (1 species)
  7. 883101Species Lactobacillus plantarum [TaxId:1590] [160803] (1 PDB entry)
    Uniprot Q88V95 1-113
  8. 883102Domain d2iaya1: 2iay A:1-113 [147592]
    complexed with cl, gol

Details for d2iaya1

PDB Entry: 2iay (more details), 1.2 Å

PDB Description: crystal structure of a duf1831 family protein (lp2179) from lactobacillus plantarum at 1.20 a resolution
PDB Compounds: (A:) hypothetical protein

SCOP Domain Sequences for d2iaya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iaya1 d.376.1.1 (A:1-113) Hypothetical protein Lp2179 {Lactobacillus plantarum [TaxId: 1590]}
maytttvkldgdtktytlsptvkkytlmdlgfvkgrsgafsfersldptspyqaafklkm
tvnadltgfkmttvtgngvqranifkndahpeaveqlryilanfierdilttd

SCOP Domain Coordinates for d2iaya1:

Click to download the PDB-style file with coordinates for d2iaya1.
(The format of our PDB-style files is described here.)

Timeline for d2iaya1: