Lineage for d2i7pa2 (2i7p A:12-152)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492576Family c.55.1.14: Fumble-like [159623] (4 proteins)
    Pfam PF03630; type II pantothenate kinase-like
  6. 2492587Protein Pantothenate kinase 3, PANK3 [159624] (1 species)
  7. 2492588Species Human (Homo sapiens) [TaxId:9606] [159625] (3 PDB entries)
    Uniprot Q9H999 12-152! Uniprot Q9H999 157-368
  8. 2492590Domain d2i7pa2: 2i7p A:12-152 [147552]
    Other proteins in same PDB: d2i7pa3, d2i7pb3, d2i7pc3
    complexed with aco

Details for d2i7pa2

PDB Entry: 2i7p (more details), 2.05 Å

PDB Description: Crystal structure of human PANK3 in complex with AcCoA
PDB Compounds: (A:) Pantothenate kinase 3

SCOPe Domain Sequences for d2i7pa2:

Sequence, based on SEQRES records: (download)

>d2i7pa2 c.55.1.14 (A:12-152) Pantothenate kinase 3, PANK3 {Human (Homo sapiens) [TaxId: 9606]}
pwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsnvaygstgirdvhlelk
dltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekdfrtignl
hlhkldeldclvkgllyidsv

Sequence, based on observed residues (ATOM records): (download)

>d2i7pa2 c.55.1.14 (A:12-152) Pantothenate kinase 3, PANK3 {Human (Homo sapiens) [TaxId: 9606]}
pwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsntgirdvhlelkdltlf
grrgnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekdfrtignlhlhkl
deldclvkgllyidsv

SCOPe Domain Coordinates for d2i7pa2:

Click to download the PDB-style file with coordinates for d2i7pa2.
(The format of our PDB-style files is described here.)

Timeline for d2i7pa2: