SCOPe 2.08: Domain d2i1sb_: 2i1s B:

Lineage for d2i1sb_ (2i1s B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.343: MM3350-like [159940] (1 superfamily)
   beta(2)-alpha-beta(4); antiparallel beta-sheet; order: 216534; similar to a ubiquitin-like fold with the extra C-terminal strand inserted in the middle of the beta-sheet

4. Superfamily d.343.1: MM3350-like [159941] (1 family)
   automatically mapped to Pfam PF07929

5. Family d.343.1.1: MM3350-like [159942] (1 protein)
   Pfam PF07929; plasmid pRiA4b ORF-3-like protein

6. Protein Hypothetical protein MM3350 [159943] (1 species)

7. Species Methanosarcina mazei [TaxId:2209] [159944] (1 PDB entry)
   Uniprot Q8PRU3 4-188

8. Domain d2i1sb_: 2i1s B: [147489]
   automated match to d2i1sa1

Details for d2i1sb_

PDB Entry: 2i1s, 2.3 Å

PDB Description: Crystal Structure of Protein of Unknown Function MM3350 from Methanosarcina mazei Go1

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2i1sb_:

Sequence, based on SEQRES records:

>d2i1sb_ d.343.1.1 (B:) Hypothetical protein MM3350 {Methanosarcina mazei [TaxId: 2209]}
kktfekvyhlklsikgitpqiwrriqvpenytfldlhkaiqavmdwedyhlhefemvnpk
tgmldkigaegddfdafggplvsekkaklsdyftlenkealytydfgdnwqvkvrlekil
prkegveypictagkraavpedsggvwgyeemlevlkdseheeyedtvlwlgddfdpeyf
dpkdvsf

Sequence, based on observed residues (ATOM records):

>d2i1sb_ d.343.1.1 (B:) Hypothetical protein MM3350 {Methanosarcina mazei [TaxId: 2209]}
kktfekvyhlklsikgitpqiwrriqvpenytfldlhkaiqavmdwedyhlhefemvnpk
tgmldkigaegddggplvsekkaklsdyftlenkealytydfgdnwqvkvrlekilprke
gveypictagkraavpedsggvwgyeemlevlkeheeyedtvlwlgddfdpeyfdpkdvs
f

Timeline for d2i1sb_:

• d2i1sb_ first appeared in SCOP 1.75, called d2i1sb1
  
• d2i1sb_ appears in SCOPe 2.07