![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.343: MM3350-like [159940] (1 superfamily) beta(2)-alpha-beta(4); antiparallel beta-sheet; order: 216534; similar to a ubiquitin-like fold with the extra C-terminal strand inserted in the middle of the beta-sheet |
![]() | Superfamily d.343.1: MM3350-like [159941] (1 family) ![]() automatically mapped to Pfam PF07929 |
![]() | Family d.343.1.1: MM3350-like [159942] (1 protein) Pfam PF07929; plasmid pRiA4b ORF-3-like protein |
![]() | Protein Hypothetical protein MM3350 [159943] (1 species) |
![]() | Species Methanosarcina mazei [TaxId:2209] [159944] (1 PDB entry) Uniprot Q8PRU3 4-188 |
![]() | Domain d2i1sa1: 2i1s A:4-188 [147488] |
PDB Entry: 2i1s (more details), 2.3 Å
SCOPe Domain Sequences for d2i1sa1:
Sequence, based on SEQRES records: (download)
>d2i1sa1 d.343.1.1 (A:4-188) Hypothetical protein MM3350 {Methanosarcina mazei [TaxId: 2209]} tfekvyhlklsikgitpqiwrriqvpenytfldlhkaiqavmdwedyhlhefemvnpktg mldkigaegddfdafggplvsekkaklsdyftlenkealytydfgdnwqvkvrlekilpr kegveypictagkraavpedsggvwgyeemlevlkdseheeyedtvlwlgddfdpeyfdp kdvsf
>d2i1sa1 d.343.1.1 (A:4-188) Hypothetical protein MM3350 {Methanosarcina mazei [TaxId: 2209]} tfekvyhlklsikgitpqiwrriqvpenytfldlhkaiqavmdwedyhlhefemvnpktg mldkigaegdplvsekkaklsdyftlenkealytydfgdnwqvkvrlekilprkegveyp ictagkraavpedsggvwgyeemlevlkdseheeyedtvlwlgddfdpeyfdpkdvsf
Timeline for d2i1sa1: