Lineage for d2i1sa1 (2i1s A:4-188)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011279Fold d.343: MM3350-like [159940] (1 superfamily)
    beta(2)-alpha-beta(4); antiparallel beta-sheet; order: 216534; similar to a ubiquitin-like fold with the extra C-terminal strand inserted in the middle of the beta-sheet
  4. 3011280Superfamily d.343.1: MM3350-like [159941] (1 family) (S)
    automatically mapped to Pfam PF07929
  5. 3011281Family d.343.1.1: MM3350-like [159942] (1 protein)
    Pfam PF07929; plasmid pRiA4b ORF-3-like protein
  6. 3011282Protein Hypothetical protein MM3350 [159943] (1 species)
  7. 3011283Species Methanosarcina mazei [TaxId:2209] [159944] (1 PDB entry)
    Uniprot Q8PRU3 4-188
  8. 3011284Domain d2i1sa1: 2i1s A:4-188 [147488]

Details for d2i1sa1

PDB Entry: 2i1s (more details), 2.3 Å

PDB Description: Crystal Structure of Protein of Unknown Function MM3350 from Methanosarcina mazei Go1
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2i1sa1:

Sequence, based on SEQRES records: (download)

>d2i1sa1 d.343.1.1 (A:4-188) Hypothetical protein MM3350 {Methanosarcina mazei [TaxId: 2209]}
tfekvyhlklsikgitpqiwrriqvpenytfldlhkaiqavmdwedyhlhefemvnpktg
mldkigaegddfdafggplvsekkaklsdyftlenkealytydfgdnwqvkvrlekilpr
kegveypictagkraavpedsggvwgyeemlevlkdseheeyedtvlwlgddfdpeyfdp
kdvsf

Sequence, based on observed residues (ATOM records): (download)

>d2i1sa1 d.343.1.1 (A:4-188) Hypothetical protein MM3350 {Methanosarcina mazei [TaxId: 2209]}
tfekvyhlklsikgitpqiwrriqvpenytfldlhkaiqavmdwedyhlhefemvnpktg
mldkigaegdplvsekkaklsdyftlenkealytydfgdnwqvkvrlekilprkegveyp
ictagkraavpedsggvwgyeemlevlkdseheeyedtvlwlgddfdpeyfdpkdvsf

SCOPe Domain Coordinates for d2i1sa1:

Click to download the PDB-style file with coordinates for d2i1sa1.
(The format of our PDB-style files is described here.)

Timeline for d2i1sa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2i1sb_