Lineage for d2hybo_ (2hyb O:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921138Fold c.114: DsrEFH-like [75168] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215
  4. 2921139Superfamily c.114.1: DsrEFH-like [75169] (3 families) (S)
  5. 2921180Family c.114.1.2: DsrH-like [117489] (3 proteins)
    Pfam PF04077
  6. 2921181Protein DsrH [142108] (1 species)
  7. 2921182Species Chromatium vinosum [TaxId:1049] [142109] (2 PDB entries)
    Uniprot O87898 2-102
  8. 2921188Domain d2hybo_: 2hyb O: [147452]
    Other proteins in same PDB: d2hyba_, d2hybb_, d2hybd_, d2hybe_, d2hybg_, d2hybh_, d2hybj_, d2hybk_, d2hybm_, d2hybn_, d2hybp_, d2hybq_
    automated match to d2hy5c1

Details for d2hybo_

PDB Entry: 2hyb (more details), 2.5 Å

PDB Description: Crystal Structure of Hexameric DsrEFH
PDB Compounds: (O:) DsrH

SCOPe Domain Sequences for d2hybo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hybo_ c.114.1.2 (O:) DsrH {Chromatium vinosum [TaxId: 1049]}
silhtvnkspfernslesclkfategasvllfedgiyaalagtrvesqvtealgklklyv
lgpdlkargfsdervipgisvvdyagfvdlttecdtvqawl

SCOPe Domain Coordinates for d2hybo_:

Click to download the PDB-style file with coordinates for d2hybo_.
(The format of our PDB-style files is described here.)

Timeline for d2hybo_: