Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.114: DsrEFH-like [75168] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215 |
Superfamily c.114.1: DsrEFH-like [75169] (3 families) |
Family c.114.1.2: DsrH-like [117489] (3 proteins) Pfam PF04077 |
Protein DsrH [142108] (1 species) |
Species Chromatium vinosum [TaxId:1049] [142109] (2 PDB entries) Uniprot O87898 2-102 |
Domain d2hybo_: 2hyb O: [147452] Other proteins in same PDB: d2hyba_, d2hybb_, d2hybd_, d2hybe_, d2hybg_, d2hybh_, d2hybj_, d2hybk_, d2hybm_, d2hybn_, d2hybp_, d2hybq_ automated match to d2hy5c1 |
PDB Entry: 2hyb (more details), 2.5 Å
SCOPe Domain Sequences for d2hybo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hybo_ c.114.1.2 (O:) DsrH {Chromatium vinosum [TaxId: 1049]} silhtvnkspfernslesclkfategasvllfedgiyaalagtrvesqvtealgklklyv lgpdlkargfsdervipgisvvdyagfvdlttecdtvqawl
Timeline for d2hybo_: