Lineage for d2hrkb_ (2hrk B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491601Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1491602Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1492349Family a.45.1.2: Arc1p N-terminal domain-like [158491] (1 protein)
    PfamB PB021108
  6. 1492350Protein GU4 nucleic-binding protein 1, Arc1p [158492] (1 species)
  7. 1492351Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [158493] (4 PDB entries)
    Uniprot P46672 4-121
  8. 1492372Domain d2hrkb_: 2hrk B: [147377]
    automated match to d2hqta1
    protein/RNA complex; complexed with cl

Details for d2hrkb_

PDB Entry: 2hrk (more details), 2.05 Å

PDB Description: Structural basis of yeast aminoacyl-tRNA synthetase complex formation revealed by crystal structures of two binary sub-complexes
PDB Compounds: (B:) GU4 nucleic-binding protein 1

SCOPe Domain Sequences for d2hrkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrkb_ a.45.1.2 (B:) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivst
lyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklein
h

SCOPe Domain Coordinates for d2hrkb_:

Click to download the PDB-style file with coordinates for d2hrkb_.
(The format of our PDB-style files is described here.)

Timeline for d2hrkb_: