SCOPe 2.08: Domain d2hkpa2: 2hkp A:403-621

Lineage for d2hkpa2 (2hkp A:403-621)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (6 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein Ulp1 protease C-terminal domain [54057] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54058] (4 PDB entries)

8. Domain d2hkpa2: 2hkp A:403-621 [147301]
   Other proteins in same PDB: d2hkpa3
   automated match to d1euva_

Details for d2hkpa2

PDB Entry: 2hkp, 2.1 Å

PDB Description: SUMO protease Ulp1 with the catalytic cysteine oxidized to a sulfenic acid

PDB Compounds: (A:) Ubiquitin-like-specific protease 1

SCOPe Domain Sequences for d2hkpa2:

Sequence, based on SEQRES records:

>d2hkpa2 d.3.1.7 (A:403-621) Ulp1 protease C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvpelnekdddqvqkalasrentqlmnrdnieitvrdfktlaprrwlndtiieffmkyie
kstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgiidl
kkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydcgi
yvcmntlygsadapldfdykdairmrrfiahliltdalk

Sequence, based on observed residues (ATOM records):

>d2hkpa2 d.3.1.7 (A:403-621) Ulp1 protease C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvpelnekdddqvqkalasrtqlmnrdnieitvrdfktlaprrwlndtiieffmkyieks
tpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgiidlkk
ktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydcgiyv
cmntlygsadapldfdykdairmrrfiahliltdalk

Timeline for d2hkpa2:

• d2hkpa2 first appeared in SCOP 1.75, called d2hkpa1
  
• d2hkpa2 appears in SCOPe 2.07