Lineage for d2hkpa1 (2hkp A:401-621)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 851268Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 851269Superfamily d.3.1: Cysteine proteinases [54001] (22 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 851683Family d.3.1.7: Adenain-like [54054] (5 proteins)
    Pfam PF02902; Ulp1 protease family
  6. 851715Protein Ulp1 protease C-terminal domain [54057] (1 species)
  7. 851716Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54058] (4 PDB entries)
  8. 851720Domain d2hkpa1: 2hkp A:401-621 [147301]
    automatically matched to d1euva_

Details for d2hkpa1

PDB Entry: 2hkp (more details), 2.1 Å

PDB Description: SUMO protease Ulp1 with the catalytic cysteine oxidized to a sulfenic acid
PDB Compounds: (A:) Ubiquitin-like-specific protease 1

SCOP Domain Sequences for d2hkpa1:

Sequence, based on SEQRES records: (download)

>d2hkpa1 d.3.1.7 (A:401-621) Ulp1 protease C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gslvpelnekdddqvqkalasrentqlmnrdnieitvrdfktlaprrwlndtiieffmky
iekstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgii
dlkkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydc
giyvcmntlygsadapldfdykdairmrrfiahliltdalk

Sequence, based on observed residues (ATOM records): (download)

>d2hkpa1 d.3.1.7 (A:401-621) Ulp1 protease C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gslvpelnekdddqvqkalasrtqlmnrdnieitvrdfktlaprrwlndtiieffmkyie
kstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgiidl
kkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydcgi
yvcmntlygsadapldfdykdairmrrfiahliltdalk

SCOP Domain Coordinates for d2hkpa1:

Click to download the PDB-style file with coordinates for d2hkpa1.
(The format of our PDB-style files is described here.)

Timeline for d2hkpa1: