SCOP 1.75: Domain d2hjqa2: 2hjq A:1-49

Lineage for d2hjqa2 (2hjq A:1-49)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily)
   beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold ((55657)) and the PsaD fold ((64243))
   beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold ((55657)) and the PsaD fold (64243))

4. Superfamily d.344.1: PriA/YqbF domain [160059] (4 families)
   associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2)

5. Family d.344.1.1: YqbF N-terminal domain-like [160060] (2 proteins)

6. Protein Hypothetical protein YqbF [160061] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [160062] (1 PDB entry)
   Uniprot P45922 1-49

8. Domain d2hjqa2: 2hjq A:1-49 [147297]
   Other proteins in same PDB: d2hjqa1

Details for d2hjqa2

PDB Entry: 2hjq

PDB Description: nmr structure of bacillus subtilis protein yqbf, northeast structural genomics target sr449

PDB Compounds: (A:) Hypothetical protein yqbF

SCOP Domain Sequences for d2hjqa2:

Sequence; same for both SEQRES and ATOM records:

>d2hjqa2 d.344.1.1 (A:1-49) Hypothetical protein YqbF {Bacillus subtilis [TaxId: 1423]}
mftaklikgktynvmgitfragvsqtvpkklyeylnenpyfiltqelnn

Timeline for d2hjqa2:

• d2hjqa2 is new in SCOP 1.75
  
• d2hjqa2 appears in SCOPe 2.01
  
• d2hjqa2 appears in the current release, SCOPe 2.08