Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily) beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold ((55657)) and the PsaD fold ((64243)) beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold ((55657)) and the PsaD fold (64243)) |
Superfamily d.344.1: PriA/YqbF domain [160059] (4 families) associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2) |
Family d.344.1.1: YqbF N-terminal domain-like [160060] (2 proteins) |
Protein Hypothetical protein YqbF [160061] (1 species) |
Species Bacillus subtilis [TaxId:1423] [160062] (1 PDB entry) Uniprot P45922 1-49 |
Domain d2hjqa2: 2hjq A:1-49 [147297] Other proteins in same PDB: d2hjqa1 |
PDB Entry: 2hjq (more details)
SCOP Domain Sequences for d2hjqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hjqa2 d.344.1.1 (A:1-49) Hypothetical protein YqbF {Bacillus subtilis [TaxId: 1423]} mftaklikgktynvmgitfragvsqtvpkklyeylnenpyfiltqelnn
Timeline for d2hjqa2: