Lineage for d2hjqa2 (2hjq A:1-49)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011286Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily)
    beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold (55657) and the PsaD fold (64243)
  4. 3011287Superfamily d.344.1: PriA/YqbF domain [160059] (5 families) (S)
    associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2)
  5. 3011288Family d.344.1.1: YqbF N-terminal domain-like [160060] (2 proteins)
  6. 3011289Protein Hypothetical protein YqbF [160061] (1 species)
  7. 3011290Species Bacillus subtilis [TaxId:1423] [160062] (1 PDB entry)
    Uniprot P45922 1-49
  8. 3011291Domain d2hjqa2: 2hjq A:1-49 [147297]
    Other proteins in same PDB: d2hjqa1, d2hjqa3

Details for d2hjqa2

PDB Entry: 2hjq (more details)

PDB Description: nmr structure of bacillus subtilis protein yqbf, northeast structural genomics target sr449
PDB Compounds: (A:) Hypothetical protein yqbF

SCOPe Domain Sequences for d2hjqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hjqa2 d.344.1.1 (A:1-49) Hypothetical protein YqbF {Bacillus subtilis [TaxId: 1423]}
mftaklikgktynvmgitfragvsqtvpkklyeylnenpyfiltqelnn

SCOPe Domain Coordinates for d2hjqa2:

Click to download the PDB-style file with coordinates for d2hjqa2.
(The format of our PDB-style files is described here.)

Timeline for d2hjqa2: