![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.375: NE1680-like [160765] (1 superfamily) beta(2)-alpha-beta-alpha-beta; 2 layers, a/b; antiparallel sheet, order 3124 |
![]() | Superfamily d.375.1: NE1680-like [160766] (1 family) ![]() automatically mapped to Pfam PF09630 |
![]() | Family d.375.1.1: NE1680-like [160767] (1 protein) Pfam PF09630; DUF2024 |
![]() | Protein Hypothetical protein NE1680 [160768] (1 species) |
![]() | Species Nitrosomonas europaea [TaxId:915] [160769] (1 PDB entry) Uniprot Q82U33 1-85 |
![]() | Domain d2hfqa1: 2hfq A:1-85 [147278] |
PDB Entry: 2hfq (more details)
SCOPe Domain Sequences for d2hfqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hfqa1 d.375.1.1 (A:1-85) Hypothetical protein NE1680 {Nitrosomonas europaea [TaxId: 915]} mqihvydtyvkakdghvmhfdvftdvrddkkaiefakqwlssigeegatvtseecrfchs ekapdevieaikqngyfiykmegcn
Timeline for d2hfqa1: