Lineage for d2hfqa1 (2hfq A:1-85)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011740Fold d.375: NE1680-like [160765] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers, a/b; antiparallel sheet, order 3124
  4. 3011741Superfamily d.375.1: NE1680-like [160766] (1 family) (S)
    automatically mapped to Pfam PF09630
  5. 3011742Family d.375.1.1: NE1680-like [160767] (1 protein)
    Pfam PF09630; DUF2024
  6. 3011743Protein Hypothetical protein NE1680 [160768] (1 species)
  7. 3011744Species Nitrosomonas europaea [TaxId:915] [160769] (1 PDB entry)
    Uniprot Q82U33 1-85
  8. 3011745Domain d2hfqa1: 2hfq A:1-85 [147278]

Details for d2hfqa1

PDB Entry: 2hfq (more details)

PDB Description: nmr structure of protein ne1680 from nitrosomonas europaea: northeast structural genomics consortium target net5
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2hfqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hfqa1 d.375.1.1 (A:1-85) Hypothetical protein NE1680 {Nitrosomonas europaea [TaxId: 915]}
mqihvydtyvkakdghvmhfdvftdvrddkkaiefakqwlssigeegatvtseecrfchs
ekapdevieaikqngyfiykmegcn

SCOPe Domain Coordinates for d2hfqa1:

Click to download the PDB-style file with coordinates for d2hfqa1.
(The format of our PDB-style files is described here.)

Timeline for d2hfqa1: